Teriparatide Acetate Powder CAS 52232-67-4

Teriparatide Acetate Powder CAS 52232-67-4


Synonym:PARATHYROID HORMONE (HUMAN, 1-34);PTH (HUMAN, 1-34);SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS NO.:52232-67-4
EINECS NO.:640-978-1
Molecular Formula:C172H278N52O47S2
Purity & Grade:99%; Medicine grade




MOQ & Package: 1g; Package according to demand

Lead Time: 5-10 days
Store & Shelf life: Cool & dry place; 24 months
Zaslať požiadavku
Popis

Xi'an Faithful BioTech Co., Ltd. is situated in Xi'an, the birthplace of the ancient Silk Road. Leveraging the city's mature logistics network and abundant fine chemical industrial resources, our enterprise has grown into an integrated fine chemical provider that delivers products to global partners. (CAS 52232-67-4) is a synthetically produced, highly active polypeptide powder composed of 34 amino acid sequences. Its structure corresponds to the core active fragment of human parathyroid hormone, exhibiting a clear molecular structure and strong biological specificity. This material is a white to off-white powder with good water solubility and is also soluble in polar organic solvents. While possessing overall stable physicochemical properties, it is hygroscopic and requires a dry, airtight environment for storage and sampling to prevent moisture from affecting its properties and biological activity.

Teriparatide acetate Powder

(CAS 52232-67-4), as a research raw material for polypeptides, is primarily used in life science research, including exploring bone metabolism mechanisms, cell proliferation and differentiation experiments, and receptor-ligand interaction analysis. It can also be used for polypeptide function verification, exploring tissue growth mechanisms, and research and development experiments in biomaterials, providing fundamental material support for laboratory-level mechanistic studies, sample testing, and project development.

White to Off-white powder
>=95.0% 96.87%
<=2.0% 1.02%
<=5.0% 2.15%
<=15.0% 8.60%
<=1 EU/mg 0.35 EU/mg

sales4@faithfulbio.com+86 17782784907

MF of Teriparatide acetate

 

Receptor-specific binding: can target and bind to the PTH-1 receptor on the cell surface, initiating downstream cell signaling pathways, triggering multi-level intracellular signal transduction, and regulating the expression levels of related genes within the cell.

Regulation of osteoblast-related cell activity: It affects the proliferation, differentiation, and survival of osteoblasts through signaling pathways, regulates cellular metabolic activity, and participates in the remodeling of bone-related tissues.

Participation in mineral transport signal regulation: Through receptor-mediated signal transduction, it participates in the regulation of mineral metabolism-related signals in the body, affecting the transport and balance of minerals in the local tissue environment.

Mediation of cytokine release: It stimulates target cells to secrete various signaling factors, indirectly regulating the behavior of surrounding cells through intercellular signal transduction, achieving biological effects at the tissue level.

Fragment functional characteristics: As a 34-amino acid fragment of the N-terminus of natural parathyroid hormone, it retains core recognition and activation capabilities, and can complete receptor activation without the need for the complete full-length molecule, making it an important tool molecule for conducting related pathway research.

Teriparatide acetate Powder

 

We adhere to the principle of "customer first, honesty first", and always provide customers with high-quality and efficient products and high-quality services. Choose faithfulness. Choose a healthy life!

With our continuous efforts and good service, we sincerely hope to establish long-term cooperation and common development with customers and give us a chance. We believe that we will satisfy you with first-class quality, safe and fast delivery and enthusiastic after-sales service.

Teriparatide acetate Powder

Teriparatide acetate Powder

Teriparatide acetate Powder

Teriparatide acetate Powder

Teriparatide acetate Powder

 

3-7 days
Suitable for under 50kg.
We have warehouses in Germany and California, USA, and customers in Europe and America can enjoy sending goods directly from these two places.
7-15 days Suitable for more than 50kg.
15-60 days Suitable for more than 500kg.

 

01. What is the mechanism of action of teriparatide acetate?

Teriparatide acetate specifically binds to the PTH-1 receptor on the cell surface, activating downstream signaling pathways, regulating related cell proliferation and differentiation, and participating in tissue remodeling and the regulation of mineral metabolism signals.

02. What is the standard purity of teriparatide acetate?

Research-grade HPLC purity is generally >=95%, with single impurities controlled below 2.0%.

03. What are the correct storage conditions for teriparatide acetate?

should be stored at -20℃ in a dry, light-protected environment, avoiding repeated freeze-thaw cycles to prevent a decrease in peptide activity.

Sales4@Faithfulbio.Com +86 17782784907

All conventional products (non-customized products) pictures are taken in kind, but due to the influence of light (different time, different background light), shooting method, different display equipment parameters and other factors, there may be some differences between the picture and the real color, product color, please take the real effect prevail, product color difference is not a product quality problem.

Always consult a qualified health practitioner before taking any new medication. This product is not intended to diagnose, treat, cure or prevent any disease.At the time of purchase, the international buyer agrees to assume the risk of all items arriving. We cannot replace lost or impounded items. Before sending items, you need to confirm that you agree to these terms.This is only a recommended dose based on our own experience and anecdotal evidence. We recommend that you do your own research before using this product.

This product is only used for scientific research, and the consequences of other uses are not responsible.

Populárne Tagy: teriparatide acetate powder cas 52232-67-4, China, suppliers, manufacturers, factory, customized, wholesale, buy, price, bulk, pure, producer, discount, for sale, in stock, free sample, raw powder, raw material, made in China